PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002012.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 293aa    MW: 32295.3 Da    PI: 8.6121
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002012.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.82.3e-3290146259
              ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                              ++vrYk ClkNhAas+Ggh++DGCgEfmp  ge+gt++alkCaAC+CHRnFHR+e + 
  Itr_sc002012.1_g00002.1  90 SSVRYKACLKNHAASMGGHVIDGCGEFMPG-GEDGTPEALKCAACDCHRNFHRKEIDG 146
                              579**************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2191145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.1E-3092144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.7E-3093144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.62894143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.21E-19218290IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28226291IPR009057Homeodomain-like
PROSITE profilePS500718.633227291IPR001356Homeobox domain
TIGRFAMsTIGR015651.3E-26229286IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MEVRGSSQQQ KDMRILHNSI GAGYPSSLDR RNNGLINQIN HPMQTLDQLQ DEAANPDPDP  60
GVLPIGPGNS AAVAPPQVLP ETSANGSGNS SVRYKACLKN HAASMGGHVI DGCGEFMPGG  120
EDGTPEALKC AACDCHRNFH RKEIDGEAPP LPPPPYFPFT PPINNNHHHS APAAMPPRNL  180
HHYSHGVAPP VMVAFGGGAA AESSSEDLNL FNHARGQVLH NPSPFSVSRK RFRTKFTQQQ  240
KDRMHEFAEK VGWKIQKQDE QQVLQFCSEV GIKRQVFKVW MHNNKQNFKK RQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-222282871675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603276.18e-92PREDICTED: zinc-finger homeodomain protein 6-like
RefseqXP_016451406.18e-92PREDICTED: zinc-finger homeodomain protein 6-like
TrEMBLA0A068U3225e-97A0A068U322_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000090333e-85(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.11e-58homeobox protein 33